Metadata-Version: 2.1
Name: bio-arc
Version: 0.1.0
Summary: Antigen Receptor Classifier
Home-page: https://github.com/iedb/arc
Author: Austin Crinklaw
Author-email: acrinklaw@lji.org
License: UNKNOWN
Description: [![Build Status](https://travis-ci.com/IEDB/ARC.svg?branch=master)](https://travis-ci.com/IEDB/ARC)
        
        # ARC (Antigen Receptor Classifier)
        ### Authors: Austin Crinklaw, Swapnil Mahajan
        
        ## Requirements:
        - Linux OS
        - [HMMER3](http://hmmer.org/)
        - NCBI Blast+
        - Python 3+
          - Python packages: Pandas, BioPython
        
        ## Installation:
        We provide a Dockerfile for ease of use.
        
        ARC can also be downloaded through PyPI using the following pip command.
        ```shell
        pip install bio-arc
        ```
        
        ### Testing Installation:
        A quick check for proper dependencies and successful installation can be performed by navigating to your pip package install directory (which can be located by executing ```pip show bio-arc```) and running the following command:
        ```shell
        python3 -m arc_test
        ```
        Passing all unit-tests means that your system is configured properly and ready to classify some protein sequences.
        
        ## Usage:
        ### Input  
        -  A fasta format file with one or more protein sequences.  
          ```
          >1WBZ_A_alpha I H2-Kb
        MVPCTLLLLLAAALAPTQTRAGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPPSTVSNMATVAVLVVLGAAIVTGAVVAFVMKMRRRNTGGKGGDYALAPGSQTSDLSLPDCKVMVHDPHSLA
        >1WBZ_B_b2m I H2-Kb
        MARSVTLVFLVLVSLTGLYAIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM
          ```
        
          
        
        ### Commands
        -  Using Fasta file as an input:
        ```shell
        python -m ARC classify -i /path/to/input.fasta -o /path/to/output.csv
        ```
        ### Output  
        -  Output file has 4 columns in CSV format. 
        -  First column named 'ID' is the description provoded in the fasta for each sequence.  
        -  Second column named 'class' is the assigned molecule class for each sequence.
           -  e.g. MHC-I, MHC-II, BCR or TCR.  
        -  The third column named 'chain_type' is the assigned chain type for each sequence.
           -  e.g. alpha, beta, heavy, lambda, kappa, scFv, TscFv or construct. These will also be labelled as V for variable domain or C for constant domain.
        -  The fourth column named 'calc_mhc_allele' is the MHC allele identified using groove domain similarity to MRO alleles.
        
        | ID	                                  | class  | chain_type | calc_mhc_allele|
        |---------------------------------------- |------- |----------- |---------------|
        | 1WBY_A_alpha I H2-Db                    |	MHC-I  | alpha V     | |
        | 1WBY_B_b2m I H2-Db	                  |	       |            | |
        | 1HQR_A_alpha II HLA-DRA*01:01/DRB5*01:01|	MHC-II | alpha C     | HLA-DRA*01:01 |
        | 1HQR_B_beta II HLA-DRA*01:01/DRB5*01:01 |	MHC-II | beta C     | HLA-DRB5*01:01 |
        | 2CMR_H_heavy                            |	BCR	   | heavy V      | |
        | 2CMR_L_light                            |	BCR	   | kappa C     | |
        | 4RFO_L_light                            |	BCR	   | lambda V    | |
        | 3UZE_A_heavy                            |	BCR	   | scFv       | |
        | 1FYT_D_alpha                            |	TCR	   | alpha V     | |
        | 1FYT_E_beta                             | TCR	   | beta C      | |
        | 3TF7_C_alpha                            |	TCR    | TscFv      | |
        
        ## How it works:
        - BCR and TCR chains are identified using HMMs. A given protein sequence is searched against HMMs built using BCR and TCR chain sequences from IMGT. HMMER is used to align an input sequence to the HMMs.
        - MHC class I (alpha1-alpha2 domains) and MHC class I alpha and beta chain HMMs are downloaded from Pfam website. An input protein sequence is searched against these HMMs. A HMMER bit score threshold of 25 was used to identify MHC chain sequences.
        - To identify MHC alleles, groove domains (G-domains) are assigned based on the MRO repository. 
        - IgNAR sequences are identified through querying against a custom blast database.
        
        ## References:
        Several methods for HMMER result parsing were sourced from ANARCI.
        
        [Dunbar J and Deane CM. ANARCI: Antigen receptor numbering and receptor classification. Bioinformatics (2016)](https://academic.oup.com/bioinformatics/article/32/2/298/1743894)
        
Platform: UNKNOWN
Classifier: Programming Language :: Python :: 3
Classifier: Operating System :: Unix
Description-Content-Type: text/markdown
