Metadata-Version: 2.1
Name: gt4sd
Version: 0.22.2
Summary: Generative Toolkit for Scientific Discovery (GT4SD).
Home-page: UNKNOWN
Author: GT4SD team
License: UNKNOWN
Description: # GT4SD (Generative Toolkit for Scientific Discovery)
        
        [![PyPI version](https://badge.fury.io/py/gt4sd.svg)](https://badge.fury.io/py/gt4sd)
        [![Actions tests](https://github.com/gt4sd/gt4sd-core/actions/workflows/tests.yaml/badge.svg)](https://github.com/gt4sd/gt4sd-core/actions)
        [![License: MIT](https://img.shields.io/badge/License-MIT-yellow.svg)](https://opensource.org/licenses/MIT)
        [![Code style: black](https://img.shields.io/badge/code%20style-black-000000.svg)](https://github.com/psf/black)
        [![Contributions](https://img.shields.io/badge/contributions-welcome-blue)](https://github.com/GT4SD/gt4sd-core/blob/main/CONTRIBUTING.md)
        [![Docs](https://img.shields.io/badge/website-live-brightgreen)](https://gt4sd.github.io/gt4sd-core/)
        [![Total downloads](https://pepy.tech/badge/gt4sd)](https://pepy.tech/project/gt4sd)
        [![Monthly downloads](https://pepy.tech/badge/gt4sd/month)](https://pepy.tech/project/gt4sd)
        
        <img src="./docs/_static/gt4sd_logo.png" alt="logo" width="500"/>
        
        The GT4SD (Generative Toolkit for Scientific Discovery) is an open-source platform to accelerate hypothesis generation in the scientific discovery process. It provides a library for making state-of-the-art generative AI models easier to use.
        
        For full details on the library API and examples see the [docs](https://gt4sd.github.io/gt4sd-core/).
        
        ## Installation
        
        ### pip
        
        If you simply want to use `gt4sd` in your projects, install it via `pip` from [PyPI](https://pypi.org/project/gt4sd/):
        
        ```sh
        pip install gt4sd
        ```
        
        You can install `gt4sd` directly from GitHub:
        
        ```sh
        pip install git+https://github.com/GT4SD/gt4sd-core
        ```
        
        ### Development setup & installation
        
        If you would like to contribute to the package, we recommend the following development setup:
        
        ```sh
        git clone git@github.com:GT4SD/gt4sd-core.git
        cd gt4sd-core
        conda env create -f conda.yml
        conda activate gt4sd
        pip install --no-deps -e .
        ```
        
        Learn more in [CONTRIBUTING.md](./CONTRIBUTING.md)
        
        ## Supported packages
        
        Beyond implementing various generative modeling inference and training pipelines GT4SD is designed to provide a high-level API that implement an harmonized interface for several existing packages:
        
        - [GuacaMol](https://github.com/BenevolentAI/guacamol): inference pipelines for the baselines models.
        - [MOSES](https://github.com/molecularsets/moses): inference pipelines for the baselines models.
        - [TAPE](https://github.com/songlab-cal/tape): encoder modules compatible with the protein language models.
        - [PaccMann](https://github.com/PaccMann/): inference pipelines for all algorithms of the PaccMann family as well as traiing pipelines for the generative VAEs.
        - [transformers](https://huggingface.co/transformers): training and inference pipelines for generative models from the [HuggingFace Models](https://huggingface.co/models)
        
        ## Using GT4SD
        
        ### Running inference pipelines
        
        Running an algorithm is as easy as typing:
        
        ```python
        from gt4sd.algorithms.conditional_generation.paccmann_rl.core import (
            PaccMannRLProteinBasedGenerator, PaccMannRL
        )
        target = 'MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTT'
        # algorithm configuration with default parameters
        configuration = PaccMannRLProteinBasedGenerator()
        # instantiate the algorithm for sampling
        algorithm = PaccMannRL(configuration=configuration, target=target)
        items = list(algorithm.sample(10))
        print(items)
        ```
        
        Or you can use the `ApplicationRegistry` to run an algorithm instance using a
        serialized representation of the algorithm:
        
        ```python
        from gt4sd.algorithms.registry import ApplicationsRegistry
        target = 'MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTT'
        algorithm = ApplicationsRegistry.get_application_instance(
            target=target,
            algorithm_type='conditional_generation',
            domain='materials',
            algorithm_name='PaccMannRL',
            algorithm_application='PaccMannRLProteinBasedGenerator',
            generated_length=32,
            # include additional configuration parameters as **kwargs
        )
        items = list(algorithm.sample(10))
        print(items)
        ```
        
        ### Running training pipelines via the CLI command
        
        GT4SD provides a trainer client based on the `gt4sd-trainer` CLI command. The trainer currently supports training pipelines for language modeling (`language-modeling-trainer`), PaccMann (`paccmann-vae-trainer`) and Granular (`granular-trainer`, multimodal compositional autoencoders).
        
        ```console
        $ gt4sd-trainer --help
        usage: gt4sd-trainer [-h] --training_pipeline_name TRAINING_PIPELINE_NAME
                             [--configuration_file CONFIGURATION_FILE]
        
        optional arguments:
          -h, --help            show this help message and exit
          --training_pipeline_name TRAINING_PIPELINE_NAME
                                Training type of the converted model, supported types:
                                granular-trainer, language-modeling-trainer, paccmann-
                                vae-trainer. (default: None)
          --configuration_file CONFIGURATION_FILE
                                Configuration file for the trainining. It can be used
                                to completely by-pass pipeline specific arguments.
                                (default: None)
        ```
        
        To launch a training you have two options.
        
        You can either specify the training pipeline and the path of a configuration file that contains the needed training parameters:
        
        ```sh
        gt4sd-trainer  --training_pipeline_name ${TRAINING_PIPELINE_NAME} --configuration_file ${CONFIGURATION_FILE}
        ```
        
        Or you can provide directly the needed parameters as argumentsL
        
        ```sh
        gt4sd-trainer  --training_pipeline_name language-modeling-trainer --type mlm --model_name_or_path mlm --training_file /pah/to/train_file.jsonl --validation_file /path/to/valid_file.jsonl 
        ```
        
        To get more info on a specific training pipeleins argument simply type:
        
        ```sh
        gt4sd-trainer --training_pipeline_name ${TRAINING_PIPELINE_NAME} --help
        ```
        
        <!-- Adding examples and notebooks is a must here -->
        
        <!-- Having a list of all supported algorithms wouldn be nice! -->
        
        ## References
        
        If you use `gt4sd` in your projects, please consider citing the following:
        
        ```bib
        @software{GT4SD,
        author = {GT4SD Team},
        month = {2},
        title = {{GT4SD (Generative Toolkit for Scientific Discovery)}},
        url = {https://github.com/GT4SD/gt4sd-core},
        version = {main},
        year = {2022}
        }
        ```
        
        ## License
        
        The `gt4sd` codebase is under MIT license.
        For individual model usage, please refer to the model licenses found in the original packages.
        
Keywords: GT4SD Generative Models Inference Training
Platform: UNKNOWN
Classifier: Operating System :: OS Independent
Classifier: Programming Language :: Python :: 3
Classifier: Programming Language :: Python :: 3.7
Description-Content-Type: text/markdown
Provides-Extra: extras
